Iright
BRAND / VENDOR: Proteintech

Proteintech, 13781-1-AP, FABP6 Polyclonal antibody

CATALOG NUMBER: 13781-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FABP6 (13781-1-AP) by Proteintech is a Polyclonal antibody targeting FABP6 in WB, IHC, ELISA applications with reactivity to human, mouse samples 13781-1-AP targets FABP6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse small intestine tissue, HepG2 cells Positive IHC detected in: human small intestine tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Fatty acid binding protein 6 (FABP6, also known as the ileal bile acid binding protein IBABP) is regarded as a bile acid binding protein found in the distal portion of the small intestine and may be important in maintaining bile acid homeostasis(PMID: 25754072). FABP6 is reportedly up-regulated in colorectal cancer, it has been suggested as a link between bile acids and the risk of colorectal cancer(PMID: 17909007). And also, it was showed a potential drug target for the treatment of diabetes(PMID: 27500412). There are 2 isoforms of this protein,one of which is about 14 kDa we detected. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4788 Product name: Recombinant human FABP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC022489 Sequence: MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Predict reactive species Full Name: fatty acid binding protein 6, ileal Calculated Molecular Weight: 177 aa, 20 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC022489 Gene Symbol: FABP6 Gene ID (NCBI): 2172 RRID: AB_2877976 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51161 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924