Iright
BRAND / VENDOR: Proteintech

Proteintech, 13986-1-AP, ANGPTL5 Polyclonal antibody

CATALOG NUMBER: 13986-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANGPTL5 (13986-1-AP) by Proteintech is a Polyclonal antibody targeting ANGPTL5 in WB, ELISA applications with reactivity to human samples 13986-1-AP targets ANGPTL5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Angiopoietin-like protein 5 (ANGPTL5) is a member of the angiopoietin-like proteins (ANGPTLs) family. Eight members have been described so far (ANGPTL1 through ANGPTL8), and have been shown to have various physiological functions in lipid and glucose metabolism, inflammation, hematopoiesis, angiogenesis and cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5053 Product name: Recombinant human ANGPTL5 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-388 aa of BC049170 Sequence: MMSPSQASLLFLNVCIFICGEAVQGNCVHHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFEVMCDMDYRGGGWTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNAGDAFRGLKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIHHFSGKLLATGIQWGTWTKNNSPVKIKSVSMKIRRMYNPYFK Predict reactive species Full Name: angiopoietin-like 5 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 45-47 kDa GenBank Accession Number: BC049170 Gene Symbol: ANGPTL5 Gene ID (NCBI): 253935 RRID: AB_2289718 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86XS5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924