Proteintech, 14025-1-AP, SOCS3 Polyclonal antibody

Size: 20ul / 150ul The SOCS3 (14025-1-AP) by Proteintech is a Polyclonal antibody targeting SOCS3 in WB, IHC, IP, ELISA applications with reactivity to human samples 14025-1-AP targets SOCS3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: K-562 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information The suppressor of cytokine signaling (SOCS) family proteins are negative feedback system that inhibits cytokine signal transduction. One of the SOCS family, SOCS3, also named CIS3 and SSI3, is involved in inhibition of JAK/STAT pathway which regulates IL-6 signaling in vivo. SOCS3 can be rapidly trigger by a number of factors including interleukins, IFN-gamma and TNF-alpha. Pathology such as inflammatory response, wound repair and obesity and so on have been linked to SOCS3. Observed MW of SOCS3 is from 22-30 kDa(PMID: 24827536,PMID: 26260587, PMID: 26797799), consistent with the result of Catalog#14025-1-AP. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5170 Product name: Recombinant human SOCS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC060858 Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL Predict reactive species Full Name: suppressor of cytokine signaling 3 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC060858 Gene Symbol: SOCS3 Gene ID (NCBI): 9021 RRID: AB_10597854 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14543 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.