Iright
BRAND / VENDOR: Proteintech

Proteintech, 14689-1-AP, DIS3 Polyclonal antibody

CATALOG NUMBER: 14689-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DIS3 (14689-1-AP) by Proteintech is a Polyclonal antibody targeting DIS3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14689-1-AP targets DIS3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, mouse ovary tissue, mouse testis tissue, HeLa cells, Jurkat cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DIS3, also named as KIAA1008 and RRP44, belongs to the ribonuclease II (RNB) family. It is a component of the exosome 3'->5' exoribonuclease complex. DIS3 is required for the 3'-processing of the 7S pre-RNA to the mature nuclear complex. It is also associated with the GTPase Ran. DIS3 has a 3'-5' exonuclease activity. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, drosophila Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6117 Product name: Recombinant human DIS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 607-958 aa of BC056143 Sequence: TTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHMDSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPELTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKLGK Predict reactive species Full Name: DIS3 mitotic control homolog (S. cerevisiae) Calculated Molecular Weight: 109 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC056143 Gene Symbol: DIS3 Gene ID (NCBI): 22894 RRID: AB_2091025 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2L1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924