Iright
BRAND / VENDOR: Proteintech

Proteintech, 15175-1-AP, LMCD1 Polyclonal antibody

CATALOG NUMBER: 15175-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LMCD1 (15175-1-AP) by Proteintech is a Polyclonal antibody targeting LMCD1 in WB, ELISA applications with reactivity to human, mouse samples 15175-1-AP targets LMCD1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Calu-1 cells, A549 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information LIM and cysteine-rich domains-1 (LMCD1) is a member of the LIM protein family, which contains an N-terminal cysteine-rich region, two C-terminal LIM domains and a central PET (Prickle, Espinas, and Testin) domain. LMCD1 has been reported in cardiac tissues and lung acting as a transcriptional repressor for GATA6. The mutations of LMCD1 promote cell migration and tumor metastasis in hepatocellular carcinoma. (PMID: 31501411) It has calculated molecular weight around 41kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7068 Product name: Recombinant human LMCD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-365 aa of BC000646 Sequence: MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS Predict reactive species Full Name: LIM and cysteine-rich domains 1 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 41-45 kDa GenBank Accession Number: BC000646 Gene Symbol: LMCD1 Gene ID (NCBI): 29995 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924