Proteintech, 15279-1-AP, DHRS4 Polyclonal antibody

Size: 20ul / 150ul The DHRS4 (15279-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS4 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 15279-1-AP targets DHRS4 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, mouse liver tissue, HeLa cells, HepG2 cells Positive IP detected in: mouse liver tissue Positive IHC detected in: human cervical cancer tissue, human cervix tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DHRS4(Dehydrogenase/reductase SDR family member 4) is also named as PHCR , NRDR ,PSCD , SCAD-SRL, and belongs to the short-chain dehydrogenases/reductases (SDR) family. It can also catalyze the oxidation of all-trans-retinol with NADP as co-factor, but with much lower efficiency. Human DHRS4 is a tetramer composed of 27 kDa subunits, which is inactivated at low temperature without dissociation into subunits(PMID:18571493). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7398 Product name: Recombinant human DHRS4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-278 aa of BC003019 Sequence: MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL Predict reactive species Full Name: dehydrogenase/reductase (SDR family) member 4 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC003019 Gene Symbol: DHRS4 Gene ID (NCBI): 10901 RRID: AB_2292856 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BTZ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.