Iright
BRAND / VENDOR: Proteintech

Proteintech, 15332-1-AP, TPSB2 Polyclonal antibody

CATALOG NUMBER: 15332-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TPSB2 (15332-1-AP) by Proteintech is a Polyclonal antibody targeting TPSB2 in WB, ELISA applications with reactivity to human, mouse samples 15332-1-AP targets TPSB2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Tryptase beta-2 (TPSB2), also known as TPS2, is a member of the peptidase S1 family and the mast cell-specific tryptase subfamily. It is a serine protease primarily expressed in mast cells and basophils. TPSB2 is synthesized as a proenzyme, stored in secretory granules, and released upon cell activation. It plays a crucial role in allergic reactions and inflammation by cleaving extracellular matrix proteins, activating protease-activated receptors (PARs), and processing cytokines like IL-33. Elevated levels of TPSB2 are associated with conditions such as asthma, allergic rhinitis, and anaphylaxis, making it a biomarker and therapeutic target in these areas. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7335 Product name: Recombinant human TPSB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-282 aa of BC065923 Sequence: LQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP Predict reactive species Full Name: tryptase beta 2 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC065923 Gene Symbol: TPSB2 Gene ID (NCBI): 64499 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20231 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924