Proteintech, 15458-1-AP, WIT1 Polyclonal antibody

Size: 20ul / 150ul The WIT1 (15458-1-AP) by Proteintech is a Polyclonal antibody targeting WIT1 in IHC, ELISA applications with reactivity to human samples 15458-1-AP targets WIT1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human ovary tumor tissue, human nephroblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7728 Product name: Recombinant human WIT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC002734 Sequence: MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHPAAADN Predict reactive species Full Name: Wilms tumor upstream neighbor 1 Calculated Molecular Weight: 10 kDa GenBank Accession Number: BC002734 Gene Symbol: WIT1 Gene ID (NCBI): 51352 RRID: AB_2878141 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.