Iright
BRAND / VENDOR: Proteintech

Proteintech, 15555-1-AP, TRAPPC3 Polyclonal antibody

CATALOG NUMBER: 15555-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRAPPC3 (15555-1-AP) by Proteintech is a Polyclonal antibody targeting TRAPPC3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 15555-1-AP targets TRAPPC3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, PC-3 cells, HEK-293 cells, mouse small intestine tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TRAPPC3 (trafficking protein particle complex 3, also known as Bet3) is a component of TRAPP, a complex involved in the tethering of transport vesicles to the cis-Golgi membrane. There are three TRAPP complexes identified in yeast with distinct roles: TRAPPI in ER-Golgi traffic, TRAPPII in intra-Golgi and endosome-Golgi traffic, and TRAPPIII in autophagy. Recently it has been proposed that at least two complexes exist in mammals. TRAPPC3 is the most conserved subunit of TRAPP and has been used to precipitate the intact tethering complex both from yeast and from human cells. It has also been reported that TRAPPC3 is required for Rabin8 centrosome trafficking and ciliogenesis. Expressed ubiquitously, TRAPPC3 protein is present in both membrane-bound and cytosolic forms. This antibody recognizes the endogenous 20-22 kDa TRAPPC3 in multiple cell lines. (15728249, 21273506, 23394947) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7924 Product name: Recombinant human TRAPPC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC007662 Sequence: MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE Predict reactive species Full Name: trafficking protein particle complex 3 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20-22 kDa GenBank Accession Number: BC007662 Gene Symbol: TRAPPC3 Gene ID (NCBI): 27095 RRID: AB_2208142 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43617 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924