Proteintech, 15589-1-AP, NDUFB10 Polyclonal antibody

Size: 20ul / 150ul The NDUFB10 (15589-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB10 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15589-1-AP targets NDUFB10 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, human skeletal muscle tissue, mouse liver tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human ovary cancer tissue, human brain tissue, human heart tissue, human kidney tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information NDUFB10(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10) is also named as PDSW and belongs to the complex I NDUFB10 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. The Complex I functions in the transfer of electrons from NADH to the respiratory chain. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7922 Product name: Recombinant human NDUFB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC005829 Sequence: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC005829 Gene Symbol: NDUFB10 Gene ID (NCBI): 4716 RRID: AB_2150790 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O96000 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.