Iright
BRAND / VENDOR: Proteintech

Proteintech, 15707-1-AP, L2HGDH Polyclonal antibody

CATALOG NUMBER: 15707-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The L2HGDH (15707-1-AP) by Proteintech is a Polyclonal antibody targeting L2HGDH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15707-1-AP targets L2HGDH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, rat brain tissue, mouse small intestine tissue, SGC-7901 cells, MCF-7 cells Positive IHC detected in: human liver cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information L2HGDH(L-2-hydroxyglutarate dehydrogenase, mitochondrial) is also named as duranin, C14orf160 and belongs to the L2HGDH family. The putative L2HGDH is predicted to be targeted to the mitochondria where its mitochondrial targeting sequence is presumably removed(PMID:16005139). Defects in L2HGDH are the cause of L-2-hydroxyglutaric aciduria (L2HGA). It has 2 isoforms produced by alternative splicing with the molecular weight of 50 kDa and 48 kDa. L2HGDH also can be detected as ~45kD due to the 51aa transit peptide cleaved. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8382 Product name: Recombinant human L2HGDH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC006117 Sequence: MVPALRYLVGACGRARGRFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDI Predict reactive species Full Name: L-2-hydroxyglutarate dehydrogenase Calculated Molecular Weight: 463aa,50 kDa; 441aa,49 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC006117 Gene Symbol: L2HGDH Gene ID (NCBI): 79944 RRID: AB_2133202 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H9P8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924