Iright
BRAND / VENDOR: Proteintech

Proteintech, 16037-1-AP, NDUFB6 Polyclonal antibody

CATALOG NUMBER: 16037-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NDUFB6 (16037-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16037-1-AP targets NDUFB6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, MCF-7 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NDUFB6, also named as NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 or Complex I-B17, is a 128 amino acid protein, which belongs to the complex I NDUFB6 subunit family. NDUFB6 localizes in the Mitochondrion inner membrane and is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8908 Product name: Recombinant human NDUFB6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC009801 Sequence: MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa Calculated Molecular Weight: 128 aa, 15 kDa Observed Molecular Weight: 16-20 kDa GenBank Accession Number: BC009801 Gene Symbol: NDUFB6 Gene ID (NCBI): 4712 RRID: AB_2235901 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95139 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924