Iright
BRAND / VENDOR: Proteintech

Proteintech, 16269-1-AP, PPM1J Polyclonal antibody

CATALOG NUMBER: 16269-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPM1J (16269-1-AP) by Proteintech is a Polyclonal antibody targeting PPM1J in WB, ELISA applications with reactivity to human, mouse, rat samples 16269-1-AP targets PPM1J in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue, rat brain tissue, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information PPM1J also known as PPP2CZ, PP2C-zeta, belongs to the PP2C family. It has a unique N-terminal region and a proline-rich domain between conserved motifs II and III. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9336 Product name: Recombinant human PPM1J protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-488 aa of BC011803 Sequence: DSRAIIVRNGEIIPMSREFTPETERQRLQLLGFLKPELLGSEFTHLEFPRRVLPKELGQRMLYRDQNMTGWAYKKIELEDLRFPLVCGEGKKARVMATIGVTRGLGDHSLKVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS Predict reactive species Full Name: protein phosphatase 1J (PP2C domain containing) Calculated Molecular Weight: 505 aa, 54 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC011803 Gene Symbol: PPM1J Gene ID (NCBI): 333926 RRID: AB_3669235 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JR12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924