Iright
BRAND / VENDOR: Proteintech

Proteintech, 16394-1-AP, MRPL44 Polyclonal antibody

CATALOG NUMBER: 16394-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRPL44 (16394-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL44 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16394-1-AP targets MRPL44 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, rat brain tissue, HeLa cells, Jurkat cells, K-562 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRP-L44 (mitochondrial ribosomal protein L44) is a 332 amino acid protein that localizes to the mitochondrion, where it exists as a component of the 39S ribosomal subunit and works in conjunction with other MRPs to mediate protein synthesis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey, zebrafish, yeast Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9485 Product name: Recombinant human MRPL44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC012058 Sequence: MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEE Predict reactive species Full Name: mitochondrial ribosomal protein L44 Calculated Molecular Weight: 332 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC012058 Gene Symbol: MRPL44 Gene ID (NCBI): 65080 RRID: AB_2146062 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H9J2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924