Iright
BRAND / VENDOR: Proteintech

Proteintech, 16922-1-AP, Vitamin D binding protein Polyclonal antibody

CATALOG NUMBER: 16922-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Vitamin D binding protein (16922-1-AP) by Proteintech is a Polyclonal antibody targeting Vitamin D binding protein in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16922-1-AP targets Vitamin D binding protein in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human blood tissue, human blood, rat eye tissue, mouse eye tissue, PC-3 cells, human plasma, mouse testis tissue Positive IHC detected in: human liver tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Vitamin D binding protein is a sparsely glycosylated serum protein responsible for highly specific binding and tissue-specific delivery of vitamin D and its metabolites. In addition, it is also an actin scavenger, and is the precursor to the immunomodulatory protein, Gc-MAF. Vitamin D binding protein has been proposed to have significant roles in C5a chemotaxis, osteoclast development and possibly in macrophage activation/recruitment. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10286 Product name: Recombinant human VDBP,GC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-474 aa of BC057228 Sequence: KLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL Predict reactive species Full Name: group-specific component (vitamin D binding protein) Calculated Molecular Weight: 474 aa, 53 kDa Observed Molecular Weight: 52-58 kDa GenBank Accession Number: BC057228 Gene Symbol: Vitamin D binding protein Gene ID (NCBI): 2638 RRID: AB_10597098 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02774 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924