Iright
BRAND / VENDOR: Proteintech

Proteintech, 17456-1-AP, FABP7 Polyclonal antibody

CATALOG NUMBER: 17456-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FABP7 (17456-1-AP) by Proteintech is a Polyclonal antibody targeting FABP7 in WB, ELISA applications with reactivity to human samples 17456-1-AP targets FABP7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information FABP7 (Fatty Acid Binding Protein-7), also known as B-FABP (Brain Fatty Acid-Binding Protein), is a member of FABP family which are intracellular proteins involved in lipid metabolism. Normally FABP7 is mainly expressed in brain and other neural tissues and is important in early nervous system development. In addition, FABP7 is considered a marker for some brain tumors and may have a role in tumorigenesis in the peripheral nervous system and in several extra nervous system neoplasms such as breast cancer, renal cancer, and melanoma. This antibody was raised against the full-length human FABP7 and may cross-react with other FABPs. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10990 Product name: Recombinant human FABP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC012299 Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA Predict reactive species Full Name: fatty acid binding protein 7, brain Calculated Molecular Weight: 132aa,15 kDa; 166aa,19 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC012299 Gene Symbol: FABP7 Gene ID (NCBI): 2173 RRID: AB_2100357 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15540 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924