Proteintech, 17616-1-AP, HEMGN Polyclonal antibody

Size: 20ul / 150ul The HEMGN (17616-1-AP) by Proteintech is a Polyclonal antibody targeting HEMGN in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 17616-1-AP targets HEMGN in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HL-60 cells, human testis tissue, mouse testis tissue Positive IP detected in: HL-60 cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11793 Product name: Recombinant human HEMGN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 139-483 aa of BC048324 Sequence: SNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSEDYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF Predict reactive species Full Name: hemogen Calculated Molecular Weight: 483 aa, 55 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC048324 Gene Symbol: HEMGN Gene ID (NCBI): 55363 RRID: AB_2117676 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXL5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.