Iright
BRAND / VENDOR: Proteintech

Proteintech, 17876-1-AP, SLC6A18 Polyclonal antibody

CATALOG NUMBER: 17876-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC6A18 (17876-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A18 in WB, ELISA applications with reactivity to human, mouse samples 17876-1-AP targets SLC6A18 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, RAW 264.7 cells, mouse brain tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SLC6A18, also known as XTRP2 and B0AT3, belongs to the SLC6 family of proteins. SLC6A18 acts as specific transporters for neurotransmitters, amino acids and osmolytes such as betaine, taurine and creatine. SLC6A18 is highly expressed at the luminal membrane of kidney proximal tubules and displays 50% identity with SLC6A19 (B0AT1), which is the main neutral amino acid transporter in both kidney and small intestine (PMID: 19478081, PMID: 21420947). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11685 Product name: Recombinant human SLC6A18 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 224-413 aa of BC056757 Sequence: LIRGLTLPGATKGLIYLFTPNMHILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNSPRNDCQKDAVVIALVNRMTSLYASIAVFSVLGFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAPVWAMLFFGMLFTL Predict reactive species Full Name: solute carrier family 6, member 18 Calculated Molecular Weight: 628 aa, 71 kDa Observed Molecular Weight: ~70 kDa GenBank Accession Number: BC056757 Gene Symbol: SLC6A18 Gene ID (NCBI): 348932 RRID: AB_3085543 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96N87 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924