Iright
BRAND / VENDOR: Proteintech

Proteintech, 17938-1-AP, LGALS9/Galectin-9 Polyclonal antibody

CATALOG NUMBER: 17938-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LGALS9/Galectin-9 (17938-1-AP) by Proteintech is a Polyclonal antibody targeting LGALS9/Galectin-9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 17938-1-AP targets LGALS9/Galectin-9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, L02 cells, NIH/3T3 cells, THP-1 cells, U-937 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-937 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The galectins, formerly known as S-type lectins, are a family of β-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-9 (LGALS9) is a tandem repeat-type member of the galectin family. It has three isoforms (named galectin-9L, galectin-9M, and galectin-9S): long type of 355 amino acids, medium type of 323 amino acids, and short type of 311 amino acids. Galectin-9 is ubiquitously expressed in a variety of tissues, including lymph nodes and spleen, and overexpressed in Hodgkin disease tissue. It is involved in chemoattraction, apoptosis, and the regulation of cell differentiation and has anti-allergic effects. It has been reported that galectin-9 is a ligand for Tim-3, through which galectin-9 can induce T-helper type 1 lymphocyte (Th1) death. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12209 Product name: Recombinant human LGALS9, Galectin-9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC110340 Sequence: MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT Predict reactive species Full Name: lectin, galactoside-binding, soluble, 9 Calculated Molecular Weight: 323 aa, 36 kDa Observed Molecular Weight: 34-40 kDa GenBank Accession Number: BC110340 Gene Symbol: Galectin-9 Gene ID (NCBI): 3965 RRID: AB_2137233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00182 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924