Iright
BRAND / VENDOR: Proteintech

Proteintech, 18008-1-AP, Neprilysin/CD10 Polyclonal antibody

CATALOG NUMBER: 18008-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Neprilysin/CD10 (18008-1-AP) by Proteintech is a Polyclonal antibody targeting Neprilysin/CD10 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 18008-1-AP targets Neprilysin/CD10 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, human kidney tissue, rat kidney tissue Positive IP detected in: Raji cells Positive IHC detected in: human kidney tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CD10, also known as neprilysin, membrane metallo-endopeptidase (MME), neutral endopeptidase (NEP), or common acute lymphoblastic leukemia antigen (CALLA), is a 100-kDa type II transmembrane glycoprotein belonging to peptidase M13 family (PMID: 7760013; 8102558). Among hematopoietic cells, CD10 is expressed on granulocytes, B cell precursors, mature germinal center B cells, a subset of immature thymocytes (PMID: 13679451). CD10 is also expressed on a variety of nonhematopoietic cell types, including bronchial epithelial cells, cultured fibroblasts, bone marrow stromal cells, renal proximal tubular epithelial cells, breast myoepithelium, biliary canaliculi (PMID: 8102558). CD10 is a cell surface peptidase that cleaves peptide bonds on the amino side of hydrophobic amino acids and inactivates a variety of physiologically active peptides. Loss or decreases in CD10 expression have been reported in a variety of malignancies (PMID: 16054017). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12506 Product name: Recombinant human MME,CD10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC106070 Sequence: MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSGMVARAYNPRGRRIA Predict reactive species Full Name: membrane metallo-endopeptidase Calculated Molecular Weight: 80aa,9 kDa; 750aa,85 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC106070 Gene Symbol: CD10 Gene ID (NCBI): 4311 RRID: AB_2146541 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08473 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924