Iright
BRAND / VENDOR: Proteintech

Proteintech, 18056-1-AP, TREML4 Polyclonal antibody

CATALOG NUMBER: 18056-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TREML4 (18056-1-AP) by Proteintech is a Polyclonal antibody targeting TREML4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 18056-1-AP targets TREML4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, mouse thymus tissue, U-937 cells Positive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12574 Product name: Recombinant human TREML4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-180 aa of BC101780 Sequence: AVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTLLVTSSKPWTAVQKSHYTIWDKPNAGFFNITMIQLTQNDSGFYWCGIYNASENIITVLRNISLVVSPAPTTSPMWTLPWLPTSTVLITSPEGTSGHPSINGSETRKSRAPACLGSG Predict reactive species Full Name: triggering receptor expressed on myeloid cells-like 4 Calculated Molecular Weight: 200 aa, 22 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC101780 Gene Symbol: TREML4 Gene ID (NCBI): 285852 RRID: AB_2878488 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXN2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924