Proteintech, 18232-1-AP, RETNLB Polyclonal antibody

Size: 20ul / 150ul The RETNLB (18232-1-AP) by Proteintech is a Polyclonal antibody targeting RETNLB in IHC, ELISA applications with reactivity to human samples 18232-1-AP targets RETNLB in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RETNLB is an intestinal goblet cell-specific protein and is notably upregulated during intestinal inflammation. RETNLB also plays a role in several research areas, such as inflammatory disease, cancer, and metabolic function. In tumors, previous reports have suggested that positive expression of RETNLB was detected in most tissues from gastric carcinoma and colon cancer patients, RETNLB was also found involvement in oral squamous cell carcinoma [PMID: 34158059 19706296 27001185 15983036]. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12912 Product name: Recombinant human RETNLB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-111 aa of BC069318 Sequence: STQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT Predict reactive species Full Name: resistin like beta Calculated Molecular Weight: 111 aa, 12 kDa GenBank Accession Number: BC069318 Gene Symbol: RETNLB Gene ID (NCBI): 84666 RRID: AB_2935447 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQ08 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.