Proteintech, 19068-1-AP, CD4 Polyclonal antibody

Size: 20ul / 150ul The CD4 (19068-1-AP) by Proteintech is a Polyclonal antibody targeting CD4 in WB, IP, ELISA applications with reactivity to human, mouse, rat, pig samples 19068-1-AP targets CD4 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: U-937 cells, pig thymus tissue, mouse thymus tissue Positive IP detected in: mouse thymus tissue Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CD4 is a 55-kDa transmembrane glycoprotein expressed on T helper cells, majority of thymocytes, monocytes, macrophages, and dendritic cells. CD4 is an accessory protein for MHC class-II antigen/T-cell receptor interaction. It plays an important role in T helper cell development and activation. CD4 serves as a receptor for the human immunodeficiency virus (HIV). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13616 Product name: Recombinant human CD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 419-458 aa of BC025782 Sequence: CVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI Predict reactive species Full Name: CD4 molecule Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC025782 Gene Symbol: CD4 Gene ID (NCBI): 920 ENSEMBL Gene ID: ENSG00000010610 RRID: AB_10603357 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01730 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.