Iright
BRAND / VENDOR: Proteintech

Proteintech, 19806-1-AP, TRIM35 Polyclonal antibody

CATALOG NUMBER: 19806-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRIM35 (19806-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM35 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 19806-1-AP targets TRIM35 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: H9C2 cells, A431 cells, HEK-293 cells Positive IHC detected in: human liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Tripartite motif 35 (TRIM35), also called hemopoietic lineage switch (Hls5), is a member of the RING finger, B box, coiled-coil (RBCC), or TRIM family E3 ligases expressed in a wide variety of hemopoietic cell types, including fetal liver progenitors. TRIM35 is reported to be a tumor suppressor gene and is expressed at low levels in several types of cancer (PMID: 34124276, 35081724). Western detected a band at 45-50 kDa possibly due to the high proline content. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13584 Product name: Recombinant human TRIM35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC018337 Sequence: MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDTAHDFRVRSLIAEERRNFLPTHQWIVTKTRLQTSSPNLQSRRQGQVQEHGACTAGEGQGLLGHAALL Predict reactive species Full Name: tripartite motif-containing 35 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 45~50 kDa GenBank Accession Number: BC018337 Gene Symbol: TRIM35 Gene ID (NCBI): 23087 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPQ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924