Iright
BRAND / VENDOR: Proteintech

Proteintech, 19811-1-AP, TLR4 Polyclonal antibody

CATALOG NUMBER: 19811-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TLR4 (19811-1-AP) by Proteintech is a Polyclonal antibody targeting TLR4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 19811-1-AP targets TLR4 in WB, IHC, IF, IP, CoIP, ChIP, ELISA, Microtiter plate binding assay applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, mouse liver tissue, RAW 264.7 cells, J774A.1 cells Positive IHC detected in: human placenta tissue, mouse brain tissue, human liver cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information TLR4, also named CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP, and TRAF6, leading to NF-kB activation, cytokine secretion, and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described. The calculated molecular weights of the three TLR4 isoforms are 96, 91, and 73 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13841 Product name: Recombinant human TLR4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 653-839 aa of BC117422 Sequence: KFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI Predict reactive species Full Name: toll-like receptor 4 Calculated Molecular Weight: 839 aa, 96 kDa Observed Molecular Weight: 90-110 kDa GenBank Accession Number: BC117422 Gene Symbol: TLR4 Gene ID (NCBI): 7099 RRID: AB_10638446 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00206 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924