Iright
BRAND / VENDOR: Proteintech

Proteintech, 19886-1-AP, PHD2/EGLN1 Polyclonal antibody

CATALOG NUMBER: 19886-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PHD2/EGLN1 (19886-1-AP) by Proteintech is a Polyclonal antibody targeting PHD2/EGLN1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 19886-1-AP targets PHD2/EGLN1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, HCT 116 cells, HEK-293 cells, HEK-293T cells, HepG2 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information EGLN1(Egl nine homolog 1) is also named as HIF-PH2,HPH-2,PHD2.It is the most important isozyme under normoxia and, through regulating the stability of HIF1, involved in various hypoxia-influenced processes such as angiogenesis in retinal and cardiac functionality. EGLN1 plays a critical role in regulating HIF levels in EPO-producing cells in humans(PMID:16407130).Defects in EGLN1 are the cause of familial erythrocytosis type 3 (ECYT3).This antibody is specific to EGLN1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13706 Product name: Recombinant human EGLN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 273-426 aa of BC005369 Sequence: MSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF Predict reactive species Full Name: egl nine homolog 1 (C. elegans) Calculated Molecular Weight: 426 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC005369 Gene Symbol: PHD2/EGLN1 Gene ID (NCBI): 54583 RRID: AB_10641986 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZT9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924