Iright
BRAND / VENDOR: Proteintech

Proteintech, 20150-1-AP, LGR4 Polyclonal antibody

CATALOG NUMBER: 20150-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LGR4 (20150-1-AP) by Proteintech is a Polyclonal antibody targeting LGR4 in IHC, ELISA applications with reactivity to human, mouse, rat samples 20150-1-AP targets LGR4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information LGR4, also known as GPR48, is a membrane of the leucine-rich GPCR family. LGR4 is composed of a large NH2-terminal extracellular domain containing 18 LRRs, the seven membrane-spanning segments, and a COOH-terminal intracellular domain. LGR4 is a receptor for R-spondins that potentiates the canonical Wnt signaling pathway and is involved in the formation of various organs. It has also been shown that LGR4 regulates cyclic AMP/protein kinase A (PKA) signalling. (PMID: 23756652; 17178856; 24212090) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13695 Product name: Recombinant human LGR4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-376 aa of BC033039 Sequence: PLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHHLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNL Predict reactive species Full Name: leucine-rich repeat-containing G protein-coupled receptor 4 Calculated Molecular Weight: 104 kDa GenBank Accession Number: BC033039 Gene Symbol: LGR4 Gene ID (NCBI): 55366 RRID: AB_2878648 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXB1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924