Iright
BRAND / VENDOR: Proteintech

Proteintech, 20305-1-AP, CD47 Polyclonal antibody

CATALOG NUMBER: 20305-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD47 (20305-1-AP) by Proteintech is a Polyclonal antibody targeting CD47 in IHC, ELISA applications with reactivity to human samples 20305-1-AP targets CD47 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human prostate cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14132 Product name: Recombinant human CD47 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC010016 Sequence: MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI Predict reactive species Full Name: CD47 molecule Calculated Molecular Weight: 323 aa, 35 kDa GenBank Accession Number: BC010016 Gene Symbol: CD47 Gene ID (NCBI): 961 RRID: AB_10732838 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08722 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924