Proteintech, 20517-1-AP, PPPDE1/PNAS4 Polyclonal antibody

Size: 20ul / 150ul The PPPDE1/PNAS4 (20517-1-AP) by Proteintech is a Polyclonal antibody targeting PPPDE1/PNAS4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 20517-1-AP targets PPPDE1/PNAS4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, NCI-H1299 cells, A549 cells, U-251 cells Positive IP detected in: A549 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:300-1:600 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information PPPDE peptidase domain 1 (PPPDE1), also named as PNAS4, is a highly conserved gene ubiquitously expressed in various tissues. PPPDE1 has been identified as a novel pro-apoptotic gene activated during the early response to DNA damage which is thought to play a critical role in cellular function regarding the maintenance of genomic integrity. This antibody specifically recognized endogenous PPPDE1, which has been confirmed by siRNA test. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14352 Product name: Recombinant human PPPDE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC004485 Sequence: MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL Predict reactive species Full Name: PPPDE peptidase domain containing 1 Calculated Molecular Weight: 194 aa, 21 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC004485 Gene Symbol: PPPDE1 Gene ID (NCBI): 51029 RRID: AB_10696177 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSY9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.