Iright
BRAND / VENDOR: Proteintech

Proteintech, 21223-1-AP, SCO2 Polyclonal antibody

CATALOG NUMBER: 21223-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCO2 (21223-1-AP) by Proteintech is a Polyclonal antibody targeting SCO2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 21223-1-AP targets SCO2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HUVEC cells, HepG2 cells Positive IHC detected in: mouse skeletal muscle tissue, human hepatocirrhosis tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Human SCO2 is a mitochondrial membrane-bound protein involved in copper supply for the assembly of cytochrome c oxidase in eukaryotes.It is involved in the maintenance of cell copper homeostasis or, limited to HSco2, as a downstream mediator of the Warburg effect, as its expression is regulated by p53(PMID:17850752).This protein belongs to the SCO1/2 family and defects in SCO2 are the cause of fatal infantile cardioencephalomyopathy with cytochrome c oxidase deficiency (FIC). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15663 Product name: Recombinant human SCO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC102025 Sequence: MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS Predict reactive species Full Name: SCO cytochrome oxidase deficient homolog 2 (yeast) Calculated Molecular Weight: 266 aa, 30 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC102025 Gene Symbol: SCO2 Gene ID (NCBI): 9997 RRID: AB_10694574 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43819 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924