Iright
BRAND / VENDOR: Proteintech

Proteintech, 21751-1-AP, SYNGR4 Polyclonal antibody

CATALOG NUMBER: 21751-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SYNGR4 (21751-1-AP) by Proteintech is a Polyclonal antibody targeting SYNGR4 in WB, ELISA applications with reactivity to human samples 21751-1-AP targets SYNGR4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15865 Product name: Recombinant human SYNGR4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 155-234 aa of BC106891 Sequence: LVWIFQAYLAFQDLRNDAPVPYKRFLDEGGMVLTTLPLPSANSPVNMPTTGPNSLSYASSALSPCLTAPKSPRLAMMPDN Predict reactive species Full Name: synaptogyrin 4 Calculated Molecular Weight: 234 aa, 26 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: BC106891 Gene Symbol: SYNGR4 Gene ID (NCBI): 23546 RRID: AB_10860264 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95473 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924