Iright
BRAND / VENDOR: Proteintech

Proteintech, 21984-1-AP, ROM1 Polyclonal antibody

CATALOG NUMBER: 21984-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ROM1 (21984-1-AP) by Proteintech is a Polyclonal antibody targeting ROM1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21984-1-AP targets ROM1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, HeLa cells, rat eye tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information ROM1 (also known as TSPAN23) is a transmembrane protein present in photoreceptor outer segment disc membranes. ROM1 belongs to the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. ROM1 is required for rod photoreceptor viability and the regulation of disk morphogenesis (PMID: 10802659). It may function as an adhesion molecule involved in stabilization and compaction of outer segment disks. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17049 Product name: Recombinant human ROM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 121-270 aa of BC008100 Sequence: LALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGS Predict reactive species Full Name: retinal outer segment membrane protein 1 Calculated Molecular Weight: 351 aa, 37 kDa Observed Molecular Weight: 37-45 kDa GenBank Accession Number: BC008100 Gene Symbol: ROM1 Gene ID (NCBI): 6094 RRID: AB_2878961 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q03395 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924