Iright
BRAND / VENDOR: Proteintech

Proteintech, 22789-1-AP, PHLPP1 Polyclonal antibody

CATALOG NUMBER: 22789-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PHLPP1 (22789-1-AP) by Proteintech is a Polyclonal antibody targeting PHLPP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 22789-1-AP targets PHLPP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human liver tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PHLPP (PH domain leucine-rich-repeats protein phosphatase) belongs to a novel family of Ser/Thr protein phosphatases that consists of PHLPP1 and PHLPP2 isoforms. It has been shown that PHLPP negatively regulates multiple oncogenic pathways by directly dephosphorylating and inactivating key signaling molecules, including Akt, S6K, and RAF1. This antibody detects both PHLPP1 alpha and PHLPP1 beta isoforms. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18794 Product name: Recombinant human PHLPP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1068-1204 aa of BC126277 Sequence: QQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTP Predict reactive species Full Name: PH domain and leucine rich repeat protein phosphatase Calculated Molecular Weight: 185 kDa, 134 kDa Observed Molecular Weight: 185 kDa GenBank Accession Number: BC126277 Gene Symbol: PHLPP Gene ID (NCBI): 23239 RRID: AB_2750897 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60346 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924