Iright
BRAND / VENDOR: Proteintech

Proteintech, 22851-1-AP, OFD1 Polyclonal antibody

CATALOG NUMBER: 22851-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OFD1 (22851-1-AP) by Proteintech is a Polyclonal antibody targeting OFD1 in IHC, IF/ICC, ELISA applications with reactivity to human samples 22851-1-AP targets OFD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells, hTERT-RPE1 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information OFD1, also named CXorf5 and 71-7A, belongs to the OFD1 family. It has been implicated in several developmental syndromes, including a male-lethal X-linked dominant condition, Oral-Facial-Digital type 1 (OFD1) syndrome, X-linked recessiveSimpson-Golabi-Behmel syndrome type 2 (SGBS2), and Joubert syndrome and related disorders (JSRDs). It is a component of the centrioles controlling mother and daughter centrioles' length. It recruits to the centriole IFT88 and centriole distal appendage-specific proteins including CEP164. Involved in the biogenesis of the cilium, a centriole-associated function. OFD1 plays an important role in development by regulating Wnt signaling and the specification of the left-right axis. This antibody recognizes all the isoforms of OFD1. The 43 kDa is isoform 2. The ~80 kDa band is unknown. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18898 Product name: Recombinant human OFD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-305 aa of BC096344 Sequence: MMAQSNMFTVADVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLIHELMHPVLSGELQPRSISVEGSSLLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKVFTMQDLLQLIKINPTSSLYKSLVSGSDKENQKGFLMHFLKELAEYHQAKESCNMETQTSSTFNRDSLAEKLQLIDDQFADAYPQRIKFESLEIKLNEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEKELTMFQNDFEKACQAKSEALVLREKSTLERIHKHQEIETKEIYAQRQLLLKDMDLLRGREAELKQ Predict reactive species Full Name: oral-facial-digital syndrome 1 Calculated Molecular Weight: 1012 aa, 117 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC096344 Gene Symbol: OFD1 Gene ID (NCBI): 8481 RRID: AB_2879177 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75665 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924