Iright
BRAND / VENDOR: Proteintech

Proteintech, 23827-1-AP, PRDM10 Polyclonal antibody

CATALOG NUMBER: 23827-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRDM10 (23827-1-AP) by Proteintech is a Polyclonal antibody targeting PRDM10 in WB, IP, ELISA applications with reactivity to human, mouse samples 23827-1-AP targets PRDM10 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information PRDM10 is a member of PRDM family, which contains a PR(PRDI-BF1 and RIZ homology) domain, and PRDM is also a subgroup of PR/SET transcription factor family for its PR domain is similar to the catalytic motif of the SET domain of histone methyltransferase(HMTase). Thus PRDM is suggested involve in the regulation of genome expression and chromatin remodeling. PRDM10 shares characteristics with the PR/SET faimly and clusters of zinc fingers DNA binding motifs. It's postualated PRDM10 has an essential role in regulating gene expression and tissue differentiation and a gene repressor. It may play a role in the pathogenesis of gangliosidosis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20605 Product name: Recombinant human PRDM10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 806-1156 aa of BC112934 Sequence: AGPGEPDPMLSTHTQLTGTIATPPVCCPHCSKQYSSKTKMVQHIRKKHPEFAQLSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVASATSPHQSQQSTVDVGQLHDPQPYPQHAIQVQHIQVSEPTASAPSSAQVSGQPLSPSAQQAQQGLSPSHIQGSSSTQGQALQQQQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVTTGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSLDPQTNSQQQTTQYIITTTTNGNGSSEVHITKP Predict reactive species Full Name: PR domain containing 10 Calculated Molecular Weight: 1156 aa, 131 kDa Observed Molecular Weight: 120-150 kDa GenBank Accession Number: BC112934 Gene Symbol: PRDM10 Gene ID (NCBI): 56980 RRID: AB_2879330 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQV6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924