Iright
BRAND / VENDOR: Proteintech

Proteintech, 24000-1-AP, ANKRD13C Polyclonal antibody

CATALOG NUMBER: 24000-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANKRD13C (24000-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD13C in WB, ELISA applications with reactivity to human, mouse samples 24000-1-AP targets ANKRD13C in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ANKRD13C, also termed as ankyrin repeat domain 13C, belongs to the ankyrin repeat domain 13 family. ANKRD13C is localized on ER membranes where it binds to DP to control its biogenesis and trafficking. ANKRD13C modulates the expression and maturation of other G pretein coupled receptors as well, indicating that ANKRD13C is a novel regulator of the biogenesis and trafficking of G pretein coupled receptors through the biosynthetic pathway. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21202 Product name: Recombinant human ANKRD13C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC028840 Sequence: MTGEKIRSLRRDHKPSKEEGDLLEPGDEEAAAALGGTFTRSRIGKGGKACHKIFSNHHHRLQLKAAPASSNPPGAPALPLHNSSVTANSQSPALLAGTNPVAVVADGGSCPAHYPVHECVFKGDVRRLSSLIRTHNIGQKDNHG Predict reactive species Full Name: ankyrin repeat domain 13C Calculated Molecular Weight: 541 aa, 61 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC028840 Gene Symbol: ANKRD13C Gene ID (NCBI): 81573 RRID: AB_2879399 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8N6S4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924