Iright
BRAND / VENDOR: Proteintech

Proteintech, 24437-1-AP, IRF8 Polyclonal antibody

CATALOG NUMBER: 24437-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IRF8 (24437-1-AP) by Proteintech is a Polyclonal antibody targeting IRF8 in WB, ELISA applications with reactivity to human samples 24437-1-AP targets IRF8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information IRFs comprise a family of transcription factors that function within the Jak/Stat pathway to regulate IFN and IFN-inducible gene expression in response to viral infection. IRFs predominantly express in lymphoid tissues and play an important role in pathogen defense, autoimmunity, lymphocyte development, cell growth, and susceptibility to transformation. The IRF family includes nine members: IRF-1, IRF-2, ISGF3γ/p48, IRF-3, IRF-4 (Pip/LSIRF/ICSAT), IRF-5, IRF-6, IRF-7, and IRF-8/ICSBP. All IRF proteins share homology in their amino-terminal DNA-binding domains. IRF family members regulate transcription through interactions with proteins that share similar DNA-binding motifs, such as IFN-stimulated response elements (ISRE), IFN consensus sequences (ICS), and IFN regulatory elements (IRF-E). IRF-8/ICSCP is expressed predominately in hematopoietic cells and is further increased upon treatment with IFN (2111015,1460054). IRF-8 can function as a transcription repressor of ICS-containing promoters (1460054). Expression of IRF-8 can lead to the down-regulation of the anti-apoptotic protein Bcl-2 (14656881). Originally described as being induced by IFN-γ, IRF-8 expression is also elevated by IRF-α as well as IL-12 in NK and T cells (14581002). IRF-8 deficient mice have enhanced susceptibility to various pathogens and impaired production of IFNs, as well as deregulated hematopoiesis that resembles chronic myelogenous leukemia (9120398). IRF-8 also regulates bone metabolism by suppressing osteoclast formation (19718038).This antibody specifically recognizes the 48kd IRF8 protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19909 Product name: Recombinant human IRF8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 121-426 aa of BC126247 Sequence: KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV Predict reactive species Full Name: ICSBP1 Calculated Molecular Weight: 426 aa, 48 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC126247 Gene Symbol: IRF8 Gene ID (NCBI): 3394 RRID: AB_2879549 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02556 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924