Iright
BRAND / VENDOR: Proteintech

Proteintech, 24956-1-AP, LCE1A Polyclonal antibody

CATALOG NUMBER: 24956-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LCE1A (24956-1-AP) by Proteintech is a Polyclonal antibody targeting LCE1A in IHC, ELISA applications with reactivity to human samples 24956-1-AP targets LCE1A in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information late cornified envelope 1A (LCE1A), also named as LEP1, is a 110 amino acid protein, which belongs to the LCE family. LCE1A is a Precursor of the cornified envelope of the stratum corneum. LCE1A is detected in dult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21047 Product name: Recombinant human LCE1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-41 aa of BC153155 Sequence: MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVS Predict reactive species Full Name: late cornified envelope 1A Calculated Molecular Weight: 110 aa, 11 kDa GenBank Accession Number: BC153155 Gene Symbol: LCE1A Gene ID (NCBI): 353131 RRID: AB_2879820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T7P2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924