Iright
BRAND / VENDOR: Proteintech

Proteintech, 25197-1-AP, COA1 Polyclonal antibody

CATALOG NUMBER: 25197-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COA1 (25197-1-AP) by Proteintech is a Polyclonal antibody targeting COA1 in IF/ICC, ELISA applications with reactivity to human samples 25197-1-AP targets COA1 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information COA1, also named as C7orf44 and MITRAC15, is a mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein with MW 15 kDa. It's a component of some MITRAC complex, a cytochrome c oxidase (COX) assembly intermediate complex that regulates COX assembly. COA1 is required for assembly of mitochondrial respiratory chain complex I and complex IV. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18313 Product name: Recombinant human C7orf44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC056884 Sequence: MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE Predict reactive species Full Name: Cytochrome c oxidase assembly factor 1 homolog Calculated Molecular Weight: 146 aa, 17 kDa GenBank Accession Number: BC056884 Gene Symbol: COA1 Gene ID (NCBI): 55744 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZY4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924