Iright
BRAND / VENDOR: Proteintech

Proteintech, 25259-1-AP, DUPD1 / DUSP27 Polyclonal antibody

CATALOG NUMBER: 25259-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DUPD1 / DUSP27 (25259-1-AP) by Proteintech is a Polyclonal antibody targeting DUPD1 / DUSP27 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 25259-1-AP targets DUPD1 / DUSP27 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Dupd1also named as Dusp27, has been categorized as an atypical dual-specificity phosphatase (Dusp) capable of dephosphorylating both tyrosine and serine/threonine residues. It's involved in the modulation of intracellular signaling cascades. In skeletal muscle Dupd1 regulates systemic glucose homeostasis by activating AMPK, which is an energy sensor protein kinase. Dupd1 also affects MAP kinase signaling though modulation of the MAPK1/2 cascade in skeletal muscle promoting muscle cell differentiation, development and atrophy. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19658 Product name: Recombinant human DUPD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-150 aa of BC137322 Sequence: MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMG Predict reactive species Full Name: dual specificity phosphatase and pro isomerase domain containing 1 Calculated Molecular Weight: 220 aa, 25 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC137322 Gene Symbol: DUSP27 Gene ID (NCBI): 338599 RRID: AB_3085779 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q68J44 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924