Iright
BRAND / VENDOR: Proteintech

Proteintech, 26037-1-AP, C16orf45 Polyclonal antibody

CATALOG NUMBER: 26037-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C16orf45 (26037-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf45 in WB, ELISA applications with reactivity to human, mouse, rat samples 26037-1-AP targets C16orf45 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22584 Product name: Recombinant human C16orf45 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 147-204 aa of BC008967 Sequence: EMADFLRIKLKPLDKVTKSPASSRAEKKAEPPPSKPTVAKTGLALIKDCCGATQCNIM Predict reactive species Full Name: chromosome 16 open reading frame 45 Observed Molecular Weight: 24-26 kDa GenBank Accession Number: BC008967 Gene Symbol: C16orf45 Gene ID (NCBI): 89927 RRID: AB_2880346 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MC5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924