Iright
BRAND / VENDOR: Proteintech

Proteintech, 26782-1-AP, TMBIM6 Polyclonal antibody

CATALOG NUMBER: 26782-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMBIM6 (26782-1-AP) by Proteintech is a Polyclonal antibody targeting TMBIM6 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 26782-1-AP targets TMBIM6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24780 Product name: Recombinant human TMBIM6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-86 aa of BC000916 Sequence: MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLG Predict reactive species Full Name: transmembrane BAX inhibitor motif containing 6 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC000916 Gene Symbol: TMBIM6 Gene ID (NCBI): 7009 RRID: AB_2880633 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55061 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924