Proteintech, 26903-1-AP, CD86 (C-terminal) Polyclonal antibody

Size: 20ul / 150ul The CD86 (C-terminal) (26903-1-AP) by Proteintech is a Polyclonal antibody targeting CD86 (C-terminal) in WB, IHC, IF-P, ELISA applications with reactivity to human samples 26903-1-AP targets CD86 (C-terminal) in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Raji cell, Ramos cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CD86 (also known as B7.2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25432 Product name: Recombinant human CD86 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 270-329 aa of BC040261 Sequence: WKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDETQRVFKSSKTSSCDKSDTCF Predict reactive species Full Name: CD86 molecule Calculated Molecular Weight: 329 aa, 38 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC040261 Gene Symbol: CD86 Gene ID (NCBI): 942 ENSEMBL Gene ID: ENSG00000114013 RRID: AB_2880677 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42081 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.