Iright
BRAND / VENDOR: Proteintech

Proteintech, 27050-1-AP, ZRANB1 Polyclonal antibody

CATALOG NUMBER: 27050-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZRANB1 (27050-1-AP) by Proteintech is a Polyclonal antibody targeting ZRANB1 in IP, ELISA applications with reactivity to human, mouse samples 27050-1-AP targets ZRANB1 in IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: HeLa cells, mouse cerebellum tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25789 Product name: Recombinant human ZRANB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of AL832925 Sequence: MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEGGSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPR Predict reactive species Full Name: zinc finger, RAN-binding domain containing 1 Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 81 kDa GenBank Accession Number: AL832925 Gene Symbol: ZRANB1 Gene ID (NCBI): 54764 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UGI0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924