Iright
BRAND / VENDOR: Proteintech

Proteintech, 27325-1-AP, CEP170 Polyclonal antibody

CATALOG NUMBER: 27325-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CEP170 (27325-1-AP) by Proteintech is a Polyclonal antibody targeting CEP170 in WB, IF/ICC, ELISA applications with reactivity to human samples 27325-1-AP targets CEP170 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26311 Product name: Recombinant human CEP170 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1012-1202 aa of BC140794 Sequence: EASDSELADADKASVASEVSTTSSTSKPPTGRRNISRIDLLAQPRRTRLGSLSARSDSEATISRSSASSRTAEAIIRSGARLVPSDKFSPRIRANSISRLSDSKVKSMTSAHGSASVNSRWRRFPTDYASTSEDEFGSNRNSPKHTRLRTSPALKTTRLQSAGSAMPTSSSFKHRIKEQEDYIRDWTAHRE Predict reactive species Full Name: centrosomal protein 170kDa Calculated Molecular Weight: 1486 aa, 165 kDa Observed Molecular Weight: 170-190 kDa GenBank Accession Number: BC140794 Gene Symbol: CEP170 Gene ID (NCBI): 9859 RRID: AB_2880844 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5SW79 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924