Iright
BRAND / VENDOR: Proteintech

Proteintech, 27689-1-AP, SASH1 Polyclonal antibody

CATALOG NUMBER: 27689-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SASH1 (27689-1-AP) by Proteintech is a Polyclonal antibody targeting SASH1 in WB, IF/ICC, ELISA applications with reactivity to human samples 27689-1-AP targets SASH1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SKOV-3 cells, U-251 cells, U-87 MG cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SAM and SH3 domain-containing protein 1 (SASH1, also known as KIAA0790 and PEPE1) is a multidomain protein implicated in various cellular processes, including cell adhesion, migration, and apoptosis. It has been identified as a novel Eph receptor-binding partner through SAM-SAM domain interactions, which are critical for the recruitment and binding of downstream molecules in the Eph signaling pathway (PMID: 37619706). SASH1 is also known to regulate signaling through focal adhesion kinase (FAK) and AKT/PI3K and promote apoptosis. Mutations in SASH1 have been associated with cancers, and it is suggested as a potential therapeutic target in non-small cell lung cancer (PMID: 33122723). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26771 Product name: Recombinant human SASH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 76-191 aa of NM_015278 Sequence: MDVCERMEELRKRRVSQDLEVEKPDASPTSLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDSSVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQ Predict reactive species Full Name: SAM and SH3 domain containing 1 Calculated Molecular Weight: 137 kDa Observed Molecular Weight: 170 kDa GenBank Accession Number: NM_015278 Gene Symbol: SASH1 Gene ID (NCBI): 23328 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94885 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924