Iright
BRAND / VENDOR: Proteintech

Proteintech, 27771-1-AP, HSPBAP1 Polyclonal antibody

CATALOG NUMBER: 27771-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSPBAP1 (27771-1-AP) by Proteintech is a Polyclonal antibody targeting HSPBAP1 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 27771-1-AP targets HSPBAP1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: PC-3 cells Positive IHC detected in: mouse kidney tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information HSPBAP1, also named as Protein associated with small stress protein 1, is a widely expressed 488 amino acid protein. HSPBAP1 may play a role in regulating stress response in the living cell(PMID: 11978969). A chromosomal aberration involving HSPBAP1 has been found in a family with renal carcinoma (PMID:12939738). HSPBAP1 has multiple isoforms with MW 55, 50, 32 and 25 kDa. Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26808 Product name: Recombinant human HSPBAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 273-451 aa of BC011897 Sequence: IELEEDHLARVEEAITRMLVCALKTAENPQNTRAWLNPTEVEETSHAVNCCYLNAAVSAFFDRCRTSEVVEIQALRTDGEHMKKEELNVCNHMEVGQTGSQNLTTGTDKPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASN Predict reactive species Full Name: HSPB (heat shock 27kDa) associated protein 1 Observed Molecular Weight: 55 kDa GenBank Accession Number: BC011897 Gene Symbol: HSPBAP1 Gene ID (NCBI): 79663 RRID: AB_2880968 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EW2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924