Iright
BRAND / VENDOR: Proteintech

Proteintech, 27926-1-AP, C19orf62 Polyclonal antibody

CATALOG NUMBER: 27926-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C19orf62 (27926-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf62 in WB, IHC, ELISA applications with reactivity to Human samples 27926-1-AP targets C19orf62 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, U-251 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27459 Product name: Recombinant human C19orf62 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-143 aa of BC000788 Sequence: SSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDKSHE Predict reactive species Full Name: chromosome 19 open reading frame 62 Calculated Molecular Weight: 329 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC000788 Gene Symbol: C19orf62 Gene ID (NCBI): 29086 RRID: AB_2881010 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924