Iright
BRAND / VENDOR: Proteintech

Proteintech, 28089-1-AP, RSAD2 Polyclonal antibody

CATALOG NUMBER: 28089-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RSAD2 (28089-1-AP) by Proteintech is a Polyclonal antibody targeting RSAD2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 28089-1-AP targets RSAD2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: fetal human brain tissue, A549 cells, mouse spinal cord tissue Positive IHC detected in: mouse stomach tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RSAD2 (radical S-adenosyl methionine domain-containing protein 2), also known as CIG5 (cytomegalovirus-induced gene 5 protein), vig1, viperin or CIG33, displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses. Expression of the protein can be induced by interferon. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27733 Product name: Recombinant human RSAD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 181-361 aa of BC017969 Sequence: DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW Predict reactive species Full Name: radical S-adenosyl methionine domain containing 2 Calculated Molecular Weight: 361 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC017969 Gene Symbol: RSAD2 Gene ID (NCBI): 91543 RRID: AB_2881057 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924