Iright
BRAND / VENDOR: Proteintech

Proteintech, 28462-1-AP, Involucrin Polyclonal antibody

CATALOG NUMBER: 28462-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Involucrin (28462-1-AP) by Proteintech is a Polyclonal antibody targeting Involucrin in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 28462-1-AP targets Involucrin in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HaCaT cells, HT-1080 cells, HT-29 cells Positive IHC detected in: human tonsillitis tissue, human brown disease, human oesophagus cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Involucrin is a protein precursor of the epidermal cornified envelope that is assembled in the outermost layers of the epidermis. Involucrin expression is restricted to the suprabasal epidermal layers (spinous and granular layers) during normal keratinocyte differentiation and is a useful marker of terminal differentiation. The predicted MW of involucrin is 68 kDa, but it also forms 120 kDa dimers, while different reports provided variable results ranging from 90-140 kDa. (PMID: 11099111, 1503502, 12150517) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29585 Product name: Recombinant human Involucrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-361 aa of NM_005547 Sequence: EVPSKQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEG Predict reactive species Full Name: involucrin Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: NM_005547 Gene Symbol: Involucrin Gene ID (NCBI): 3713 RRID: AB_2881148 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07476 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924